PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI06G00710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 391aa    MW: 42252.6 Da    PI: 6.0398
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI06G00710.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.5e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+llv+++ ++G g+W++ ++  g++R++k+c++rw +yl
  OMERI06G00710.1 15 KGPWTPEEDKLLVEYIGKHGHGSWRRLPKLAGLNRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding50.54.7e-1668113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +T +E+ l++++++ lG++ W++Ia ++  gRt++++k++w+++l
  OMERI06G00710.1  68 RGDFTDDEERLIIHLHATLGNK-WSSIATKLK-GRTDNEIKNYWNTHL 113
                      899*******************.********9.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-25765IPR009057Homeodomain-like
PROSITE profilePS5129419.7711062IPR017930Myb domain
SuperFamilySSF466891.76E-3012109IPR009057Homeodomain-like
SMARTSM007171.7E-151464IPR001005SANT/Myb domain
PfamPF002492.4E-171562IPR001005SANT/Myb domain
CDDcd001672.77E-121762No hitNo description
PROSITE profilePS5129427.1463117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2566117IPR009057Homeodomain-like
SMARTSM007171.9E-1567115IPR001005SANT/Myb domain
PfamPF002497.2E-1568113IPR001005SANT/Myb domain
CDDcd001671.02E-1171113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MGRSPCCEQD ADVKKGPWTP EEDKLLVEYI GKHGHGSWRR LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGD FTDDEERLII HLHATLGNKW SSIATKLKGR TDNEIKNYWN THLRKKLLSQ  120
GIDPVTHRPR TDLLAGLPNL LAAANLGGAA HQLPLDFNAI KLQADAAKFQ ILQGLLRVLS  180
TATAPPTAAV LPGTDLMTSI LGATLAANSA GILGQQQLAG VDLSRLGQYN GNYDNLPPLT  240
NDSCTQQTQP PMSSMSPDSL LNRISSGISG DMLSSPELCH GGDRLSSPEL GQGGPSASNM  300
TTSPMAPPPP MVAADDHQCN TNTPSGGGDG MSCEQTPASS TFDGLNLDDI DINDMEGCWA  360
MTDILLADSP DWSRWNNNAM PIMVDQQQQR K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29121174108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641987.10.0PREDICTED: transcription factor MYB76
TrEMBLA0A0E0DVQ80.0A0A0E0DVQ8_9ORYZ; Uncharacterized protein
STRINGLOC_Os06g02250.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA022174-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.21e-75myb domain protein 9